PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P24710_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 583aa    MW: 65343 Da    PI: 9.4098
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P24710_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS47.62.9e-15320408293
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++lL+ecA+a+s+++ e+ + l+ + +  +s +g+p+qRl ay++e+L ar  +s++++y+ l++++ +   s+e l+++ ++++++P
  GSMUA_Achr9P24710_001 320 KQLLIECAKALSENKIEEFELLVGKAHRAVSISGEPLQRLGAYMLEGLVARHESSGTNIYHGLRSRKPE---SKELLSYMGILYDICP 404
                            689***************************************************************999...99************** PP

                   GRAS  90 ilkf 93 
                            ++k 
  GSMUA_Achr9P24710_001 405 YFKT 408
                            *996 PP

2GRAS216.71.2e-66407582197373
                   GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                            k+gEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+++n+++Fl+rf+e+l+yysa+f+s++a+l r+s+eri 
  GSMUA_Achr9P24710_001 407 KTGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESNTNTTPFLTRFIETLDYYSAMFESIDATLKRDSKERID 494
                            78************************************************************************************** PP

                   GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                            vE+++l+++ivn++ace+++r+erhe l+kWr+rl++aGFkp+pls+++++ +k+ll+ ++++ y+  e++g+l+lgWk+r+L+s+Sa
  GSMUA_Achr9P24710_001 495 VEQHCLAKDIVNIIACEEKDRVERHELLGKWRSRLSMAGFKPYPLSSYVNSVIKTLLSYYSNK-YTAVEKDGALLLGWKTRNLISASA 581
                            **********************************************************99966.************************ PP

                   GRAS 373 W 373
                            W
  GSMUA_Achr9P24710_001 582 W 582
                            * PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098526.518407564IPR005202Transcription factor GRAS
PfamPF035144.3E-64407582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MITKPSFLAC VTVYTRSIAY VVYPSNATTA SVAVGPTTSV HSSPGRMRVG VKGIIITPVE  60
YANLTCRLPP KEGAHDHVSP CLTRTREDGR LGWSQSGQKR RNIRESDPPP SNVHPTVARD  120
TSGHLLTPPA WESEDIYRES YSLQNRSYTE WTFDSIKSAL GNSLNSPTSS RFEFFPLLSN  180
SQEQNSFTKP SRVSKSGLDS IQAVPSSSSR DPRTIRLTYA VSSQSMKHTL QELGIVLMAP  240
DTVKPTTSTD PELNENKQPQ LTKQRSRTWT HKTQLESPTI PQPRYTSGGH MNISHEARPG  300
KRVREVRKQS GTDVKQPDVK QLLIECAKAL SENKIEEFEL LVGKAHRAVS ISGEPLQRLG  360
AYMLEGLVAR HESSGTNIYH GLRSRKPESK ELLSYMGILY DICPYFKTGE ALAVNFTLQL  420
HHTPDESVDV NNPRDGLLRM VKGLSPKVTT LVEQESNTNT TPFLTRFIET LDYYSAMFES  480
IDATLKRDSK ERIDVEQHCL AKDIVNIIAC EEKDRVERHE LLGKWRSRLS MAGFKPYPLS  540
SYVNSVIKTL LSYYSNKYTA VEKDGALLLG WKTRNLISAS AWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-29410583201375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577067.11e-155PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 21
SwissprotQ69VG11e-102CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM0U3780.0M0U378_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P24710_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-83GRAS family protein